Protein Info for CA264_03840 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: 4-hydroxythreonine-4-phosphate dehydrogenase PdxA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 52% identical to PDXA_BACTN: 4-hydroxythreonine-4-phosphate dehydrogenase (pdxA) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K00097, 4-hydroxythreonine-4-phosphate dehydrogenase [EC: 1.1.1.262] (inferred from 56% identity to dfe:Dfer_0418)

Predicted SEED Role

"4-hydroxythreonine-4-phosphate dehydrogenase (EC 1.1.1.262)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.1.1.262)

MetaCyc Pathways

pyridoxal 5'-phosphate biosynthesis I (6/7 steps found)
superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (7/12 steps found)

KEGG Metabolic Maps

Vitamin B6 metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.262

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YP27 at UniProt or InterPro

Protein Sequence (340 amino acids)

>CA264_03840 4-hydroxythreonine-4-phosphate dehydrogenase PdxA (Pontibacter actiniarum KMM 6156, DSM 19842)
MDNKYKVKLGISIGDTNGIGPEVIIKTLSDNRILNYCTPVIYGAADLLNKVRKALGADHF
NFQQVDSAQALVPRKVNLVSCWDNGLEVNPGTPTAESGKASLDSLLAASRDLKAGLLDGL
VTAPINKDNIQAEEFKFPGHTEFLTSYFDAPESLMLLVSGDLRVATVTGHMPLQEVPGRI
TEQLLIRKLTILLESLRTDFGILKPRVAVLGLNPHAGEQGLLGKEDQEVIRPTIMQMKER
GHLVFGPYPADGFFGMQQYRQVDAVLAMYHDQGLIPFKTLAFESGVNYTAGLPVVRTSPD
HGTAYDIASKHIANETSFREALFLACDIIRKRQMEAKPAL