Protein Info for CA264_03805 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: serine protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 230 to 251 (22 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details amino acids 284 to 303 (20 residues), see Phobius details amino acids 309 to 328 (20 residues), see Phobius details amino acids 346 to 364 (19 residues), see Phobius details PF01972: SDH_sah" amino acids 69 to 128 (60 residues), 20.4 bits, see alignment E=2.4e-08 PF01957: NfeD" amino acids 354 to 450 (97 residues), 42.2 bits, see alignment E=9.3e-15

Best Hits

KEGG orthology group: K07403, membrane-bound serine protease (ClpP class) (inferred from 55% identity to mtt:Ftrac_3215)

Predicted SEED Role

"Putative membrane-bound ClpP-class protease associated with aq_911" in subsystem YbbK

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YP66 at UniProt or InterPro

Protein Sequence (456 amino acids)

>CA264_03805 serine protease (Pontibacter actiniarum KMM 6156, DSM 19842)
MKSYPKHRHQHTYYLLLCLLLLPFFSLAQQAARPKVFVMEVKSEIDPRTNRYTELALEEA
TEVGADHVLLVLDTFGGALNDADEIRKRILEYPKPVYVFINKNAASAGALISLACDSIYM
APGANIGAATVVGADGAAAPGKYQSYMRSIMRSTAEANGRNPHLAESMVEASVDSTLSAG
QVLTLTTTEAIKYGFCDGVAVNVEGVLEELHLQDAQLINYELSTTDRIVSFFLNPFISGI
LLLVIVGGLYFELQTPGIGFPLLAALVAGVLYLVPYYLNGLAENWEILMFVAGIVLIMLE
LFVVPGFGITGISGITLTVVSLVLVMVNNQAFDFTFVPSENLMKSMVSVLAGMIGAAVVI
AFTWNRLLNSRSMQHVVLQNTFNSREGYRSANTAEHLVGRTGVAYTRMAPSGRIMIDDVL
YDAQAREGFIEKGDTVQVIDQSTFALRVKRVEVKST