Protein Info for CA264_03630 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: PAS domain-containing sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 652 TIGR00229: PAS domain S-box protein" amino acids 18 to 139 (122 residues), 59.1 bits, see alignment E=2.4e-20 amino acids 150 to 277 (128 residues), 68.7 bits, see alignment E=2.6e-23 amino acids 285 to 410 (126 residues), 65.4 bits, see alignment E=2.7e-22 PF00989: PAS" amino acids 20 to 131 (112 residues), 43.8 bits, see alignment E=8.1e-15 amino acids 154 to 266 (113 residues), 38.8 bits, see alignment E=3e-13 amino acids 302 to 400 (99 residues), 27.8 bits, see alignment E=7.9e-10 PF08448: PAS_4" amino acids 27 to 136 (110 residues), 29.3 bits, see alignment E=2.9e-10 amino acids 167 to 270 (104 residues), 32.8 bits, see alignment E=2.6e-11 amino acids 302 to 407 (106 residues), 32.1 bits, see alignment E=4.1e-11 PF13426: PAS_9" amino acids 32 to 134 (103 residues), 47.9 bits, see alignment E=4.7e-16 amino acids 167 to 269 (103 residues), 50.6 bits, see alignment E=7e-17 amino acids 302 to 404 (103 residues), 50.1 bits, see alignment E=1e-16 PF02518: HATPase_c" amino acids 537 to 643 (107 residues), 69.5 bits, see alignment E=1.2e-22

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNZ1 at UniProt or InterPro

Protein Sequence (652 amino acids)

>CA264_03630 PAS domain-containing sensor histidine kinase (Pontibacter actiniarum KMM 6156, DSM 19842)
MNVEPDAVSSYSPSETTLDQYRILVESIADYAIFLLDTTGHVVTWNTGARQVEQYEAEEI
IGKHFSVFYTAEDKATDSAAKELAEAKIRGRYEDEGWRVKKDGSVFWSNVVIAPVYNPDA
ELSGYSVVVRDLSEKKKEDDDLYRAYQELKESEERFRLLIEGVTDYAILMLDPAGNVATW
NEGARRMKGYEAEEIIGKYFSKFYNRESILQGFPDHELRQAKANGSFEDNGWRYRKDGTA
FWANTVLTAIYNADKELIGFSKITRDLTEKLRMEQQLFQINEELKESEEKSRLLIDSVKD
YAILMLNPEGIVMSWNVGAERIKGYAAKEIIGRHFSTFYTREAIEKGFPQYELRKALEFG
HFEDEGWRIRKGGNAFWANVVITPVYNSDNRLLGFAKITRDLTERRRNEELMLKNKELVK
INNELDNFVYAASHDLKAPITNLEGLLTALEEDLGQDRGKHEAILRLMEGSIGKLKDVIA
DLSDVTKLNHAEATAESVHIPGLLEEIKGSLDPMLKRSKAEIAIEDLAFDRLSYPRKNLR
SILFNLVSNAVKYSDPQRKPIIKISSSITSDGDYVLSVADNGLGVAPRQVGKIFSLFKRA
HGHVEGSGIGLYLVKRILDNSGDSIMVDSKEGVGSTFRVYFKQQDTPAEVKK