Protein Info for CA264_03625 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: proline iminopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR01250: proline-specific peptidase" amino acids 54 to 344 (291 residues), 332.7 bits, see alignment E=1.2e-103 PF12146: Hydrolase_4" amino acids 73 to 313 (241 residues), 53.3 bits, see alignment E=5.1e-18 PF00561: Abhydrolase_1" amino acids 77 to 331 (255 residues), 91 bits, see alignment E=2e-29 PF12697: Abhydrolase_6" amino acids 77 to 332 (256 residues), 50.4 bits, see alignment E=9.7e-17 PF00975: Thioesterase" amino acids 79 to 235 (157 residues), 37.2 bits, see alignment E=7.3e-13

Best Hits

Swiss-Prot: 60% identical to PIP_ELIME: Proline iminopeptidase (fpaP) from Elizabethkingia meningoseptica

KEGG orthology group: K01259, proline iminopeptidase [EC: 3.4.11.5] (inferred from 69% identity to ttr:Tter_2662)

Predicted SEED Role

"Proline iminopeptidase (EC 3.4.11.5)" in subsystem Proline, 4-hydroxyproline uptake and utilization (EC 3.4.11.5)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.11.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YP25 at UniProt or InterPro

Protein Sequence (353 amino acids)

>CA264_03625 proline iminopeptidase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKVMFSALLLGFSVLQGCSAPAEAPATATNTTAPSYLDSSGREDELSGGARMIQITTPKG
AFNVWTKRVGNSPTMKVLLLHGGPGGTHEAFECFDSYLPKEGIEYYYYDQLGSHYSDQPQ
DTSLWNTARFVEEVEQVRQALHLDKDNFYLLGHSWGGILAMEYALKYQQHLKGLIISNMM
SSVPAYNAYAEEVLGPQMDPQVLAELKQIEANGDFYNPRYMELLLPNFYTKHALRMPIER
WPDPVNRMFNHMNQTVYVQMQGHSEFGITGNASLKNWDRSADLPKITVPTLTIGGQHDTM
DPEHMKWMAGQLPKGSYLHCPSGSHMAMYDDQKTYFSGLTKFIKAVDEGSEKP