Protein Info for CA264_03595 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: sodium:alanine symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 62 to 85 (24 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 137 to 158 (22 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 232 to 256 (25 residues), see Phobius details amino acids 293 to 313 (21 residues), see Phobius details amino acids 353 to 374 (22 residues), see Phobius details amino acids 389 to 407 (19 residues), see Phobius details amino acids 413 to 435 (23 residues), see Phobius details TIGR00835: amino acid carrier protein" amino acids 13 to 446 (434 residues), 498.4 bits, see alignment E=8.2e-154 PF01235: Na_Ala_symp" amino acids 51 to 458 (408 residues), 538.6 bits, see alignment E=6.1e-166

Best Hits

Swiss-Prot: 65% identical to YRBD_BACSU: Putative sodium/proton-dependent alanine carrier protein YrbD (yrbD) from Bacillus subtilis (strain 168)

KEGG orthology group: K03310, alanine or glycine:cation symporter, AGCS family (inferred from 75% identity to shg:Sph21_0204)

Predicted SEED Role

"sodium/alanine symporter family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YP38 at UniProt or InterPro

Protein Sequence (484 amino acids)

>CA264_03595 sodium:alanine symporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MEHIISFINDIVWSNALIILCLGAGIYFSIVTRFVQVRYIREMLRLLFHGESSQKGVSSF
QAFSIAIAGRVGTGNIAGVATAIAMGGPGAVFWMWVIAFLGSASAYIEATLGQIYKQVKD
GEYRGGPAYYIEKGLGVRWYAVVFAIATIISMALFLPGVQSNSIASGINTAFGVPMAVTG
AAVTALLALIIFGGVKRIGKVAEVAVPFMAGAYILMTVVIIAMNVTEVPAMISLIVRSAF
DVEPAFAGVFGMAISWGVKRGIYSNEAGQGTAPHAAAAAEVSHPAKQGLVQAFSVYVDTL
FVCTATAFMILFTGQYNVVNPEGGFIVENLPGVAFGPEFTQQAVNTYFPSLGSGFVAISL
LLFAFTTIMAYYYIAETNLSYLNAKGNKWMLWALRALILAATFYGSVKTAESAWMLGDIG
VGIMAWLNVVAILLLRKPALRALKDYQAQRKAGLDPVFHPKQLGIQNADQWDKTAEENKE
LQAV