Protein Info for CA264_03470 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: short-chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF00106: adh_short" amino acids 12 to 202 (191 residues), 197.5 bits, see alignment E=2.5e-62 PF08659: KR" amino acids 14 to 166 (153 residues), 49 bits, see alignment E=1.1e-16 PF13561: adh_short_C2" amino acids 18 to 251 (234 residues), 231.1 bits, see alignment E=2.1e-72

Best Hits

Swiss-Prot: 43% identical to LINC_SPHIB: 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase (linB) from Sphingobium indicum (strain DSM 16412 / CCM 7286 / MTCC 6364 / B90A)

KEGG orthology group: None (inferred from 63% identity to tra:Trad_0885)

MetaCyc: 58% identical to cyclohexanol dehydrogenase (Aromatoleum aromaticum EbN1)
1.1.1.-

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNZ4 at UniProt or InterPro

Protein Sequence (256 amino acids)

>CA264_03470 short-chain dehydrogenase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKGTIQKQFTGKVALVTGASSGIGKATALQYAREGAKVVVSDIKEDEGLKVVEEIKQSGG
EAVFVAADVAKPEDCENLVKQAVAHYGQLNIAFNNAGIGGEAKPIGEMDVESWNRVIAVN
LSSVFYCMHYQVKQMLQNGGGAIVNNSSILGQVGFANSAAYVAAKHGVVGLTKNGALEYA
AKGIRVNLVGPAFIKTPLLTEAGMENETLQMLAQLHPIGRLGEAEEVAELVIWLSSDKAS
FVTGAYYAVDGAYLAQ