Protein Info for CA264_03410 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: glutamine amidotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 PF07722: Peptidase_C26" amino acids 126 to 253 (128 residues), 118 bits, see alignment E=5.3e-38 PF00117: GATase" amino acids 133 to 269 (137 residues), 53.7 bits, see alignment E=2.3e-18

Best Hits

KEGG orthology group: K07010, putative glutamine amidotransferase (inferred from 48% identity to tgr:Tgr7_3159)

Predicted SEED Role

"Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis or Tryptophan synthesis (EC 2.6.1.85)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85

Use Curated BLAST to search for 2.6.1.85

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNY7 at UniProt or InterPro

Protein Sequence (306 amino acids)

>CA264_03410 glutamine amidotransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MAAMRQVQKINRGRPTIGVTGPDKGGEAAWLFTALSVWLAGGKPVRITPARPRTADGLQA
LIVGGGADVDPSTYEQAHVIEDYLQQTIRQPHTNIFKRIGRFARWLYFPALFFVRKLLSR
KPQFGLDRDRDHLELQLIDQAAKKDLPLMGICRGAQLLNVYFRGTLYKSINTFYTEAPNP
ASIFPVKEVSIEAGSKLGSVLGVQRLEVNALHNQAVKEPGEGIAIVAREPNQVVQGIEHL
SHDYMVGVQWHPEYLPQFAVHRRLFKALVQQAREVSQQIEERDMQEALAHPNPTLLQKLE
AQTEKE