Protein Info for CA264_03355 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: VWA domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 621 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13620: CarboxypepD_reg" amino acids 25 to 97 (73 residues), 38.5 bits, see alignment E=4.3e-13 PF13715: CarbopepD_reg_2" amino acids 26 to 108 (83 residues), 66 bits, see alignment E=9e-22 PF12450: vWF_A" amino acids 148 to 239 (92 residues), 143.4 bits, see alignment E=6e-46 PF13768: VWA_3" amino acids 256 to 413 (158 residues), 37 bits, see alignment E=1.2e-12 PF00092: VWA" amino acids 256 to 417 (162 residues), 64.4 bits, see alignment E=5.7e-21 PF13519: VWA_2" amino acids 257 to 361 (105 residues), 53.7 bits, see alignment E=1e-17 PF12034: YfbK_C" amino acids 432 to 614 (183 residues), 252.3 bits, see alignment E=1.2e-78

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 62% identity to mtt:Ftrac_2313)

Predicted SEED Role

"Von Willebrand factor type A domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNU6 at UniProt or InterPro

Protein Sequence (621 amino acids)

>CA264_03355 VWA domain-containing protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MEKHLYTLLLALLMLGLQAQAQTLQVTGTVTDAANGAALPGVTVTGKGTQAGTVTDQYGK
YTLRVQSEKTVLVFGFIGYITQEVKVGKKRVVDVQLQADTQALEEVVVTAHGRPKGITIR
GVATSAVVSAPQQYSSGYMAYDQAALHNTENYDYLKESTFQDAKESPLSTFSIDVDRASY
SNVRRFLNNGQKPPVDAVRIEEMVNYFTYDYPQPKGEEPFAVYTELSACPWNKENQLLHI
GLQGKDIPTDNLPPSNLVFLLDVSGSMATPNKLPLLKVGLNLLVSQLRPQDKVAIVVYAG
AAGLALPATSGDQKEKIAQALGQLEAGGSTAGGAGIRLAYQVAQEQFMEGGNNRVILATD
GDFNVGVSSDGELARLIEEKRETGIALTVLGVGTGNLKDSRMEQLADKGNGNYAYIDNIL
EAKKVFVNEFGGTLFTIAKDVKLQLEFNPAKVKSYRLIGYENRTLQSKDFNDDKKDAGEL
GAGHTVTALYEIVPAGAKGGSAGSVDELRYQESKLRAKAAATNEILTLKLRYKEPGGSKS
KLLSTTVSGAATEVSQASDNLRFAGAVAAFGMLLRDSAFKGTATYAQVLALAQSALGKDA
EGYRAEFVRLVESRALLSDRR