Protein Info for CA264_03330 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: peptide-methionine (R)-S-oxide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 TIGR00357: methionine-R-sulfoxide reductase" amino acids 24 to 149 (126 residues), 172.4 bits, see alignment E=2.3e-55 PF01641: SelR" amino acids 28 to 146 (119 residues), 158.9 bits, see alignment E=2.6e-51

Best Hits

Swiss-Prot: 56% identical to MSRB_THEEB: Peptide methionine sulfoxide reductase MsrB (msrB) from Thermosynechococcus elongatus (strain BP-1)

KEGG orthology group: K07305, peptide-methionine (R)-S-oxide reductase [EC: 1.8.4.12] (inferred from 61% identity to hhy:Halhy_3148)

MetaCyc: 47% identical to methionine sulfoxide reductase B (Escherichia coli K-12 substr. MG1655)
L-methionine (R)-S-oxide reductase. [EC: 1.8.4.14]; Peptide-methionine (R)-S-oxide reductase. [EC: 1.8.4.14, 1.8.4.12]

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12)" (EC 1.8.4.12)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.4.12

Use Curated BLAST to search for 1.8.4.12 or 1.8.4.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNZ2 at UniProt or InterPro

Protein Sequence (151 amino acids)

>CA264_03330 peptide-methionine (R)-S-oxide reductase (Pontibacter actiniarum KMM 6156, DSM 19842)
MLRWIDVIKFAKYSNPEPDRRVEKTDEEWQQLLTEEQYRVTRQKGTERPYKNAYCRSFEP
GRYACVCCGSLLFGSGEKYRSPLSGWPSFTQPIRKGAIKYTFDDSHKMNRVEVLCNVCDS
HLGHIFNDGPAPGGLRYCVNSASITLLDKDA