Protein Info for CA264_03250 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: metal transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 338 to 355 (18 residues), see Phobius details amino acids 361 to 381 (21 residues), see Phobius details amino acids 387 to 408 (22 residues), see Phobius details PF00873: ACR_tran" amino acids 6 to 421 (416 residues), 386.8 bits, see alignment E=9.9e-120

Best Hits

KEGG orthology group: None (inferred from 75% identity to psn:Pedsa_0677)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcA; Cation efflux system protein CusA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNS2 at UniProt or InterPro

Protein Sequence (424 amino acids)

>CA264_03250 metal transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MIEKLISFSLRNRVFVLLISAVLFGWGLYSVQTNKVDAIPDLSENQVIVFTEWMGRSPQI
IEDQVTYPLVTNLQGLPEVKYVRGSSMFGMSFIYIIFEDDTDVYWARSRVLERLNSVGNA
LPEGVTPTLGPDGTGVGHVLWYTFDAPGMDLGEQRAVQDWYVKFALQNVEGVSEVASFGG
FQKQYQVTVDPNKLTYYNLTVPQVIQAVRANNNEAGGRKFERSDIGYIIKTTGYLKSAEE
IENIAITTNNTIPVRVQDVATVQMTGESRLGIFDLNGEGEAVGGIVVMRYGENAEEVISN
VKEKMAEVSKGLPEGMEFNIVYDRSGLINESIASVKNTLIEEMIVASVVVFLFLFHWRSA
LVIIIQLPLSVAIGFILLNAFDISSNIMSLTGIALSIGVIVDDAIVMVENSYRHLAEASK
RNSE