Protein Info for CA264_03230 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF19335: HMBD" amino acids 33 to 58 (26 residues), 55.2 bits, see alignment (E = 1.3e-18) PF16576: HlyD_D23" amino acids 99 to 218 (120 residues), 110.9 bits, see alignment E=1.4e-35 amino acids 260 to 349 (90 residues), 59.4 bits, see alignment E=8e-20 PF16572: HlyD_D4" amino acids 143 to 196 (54 residues), 33.2 bits, see alignment 9.5e-12 PF13437: HlyD_3" amino acids 260 to 344 (85 residues), 45.1 bits, see alignment E=3.6e-15

Best Hits

KEGG orthology group: None (inferred from 48% identity to sli:Slin_6878)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNX5 at UniProt or InterPro

Protein Sequence (434 amino acids)

>CA264_03230 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MKRYLNILFLLLLVAFGACQSDPHSEAAAETTYTCPMHPQIVQDEPGTCPICGMDLVPTS
AHGVEIEITEDLAFLLQPTNETVVANINTIKPARKAVPATVEMEGLITYDERRIYSIPAQ
VGGRIEKLFVKYNYQPINKGQKLMEVYSPELVTAQKELLYLVQSAPEDKALLKAAKQRLR
LLGATEAQVNRLIRSGEASYTFAIYSPYDGYVVGLNTTAPSATPSATAVTAPGGAGGMGA
GNTNPGMAGSGAATPAAGSELQLREGMYVSTGQPLLRVVNPNQLWAEFNVPAGEVTAIAK
GAPVQVTFPQLPGEKLEAQVDFLQPFYEAGENFAKVRVYLPGQQQLARIGQLVSATASYT
TAPALWVPREAVLDIGTRSVAFKKTNGAFKPVAVTVGTVEGNQVQVVDGLEQTDIIAANA
QFMVDSESFVKINE