Protein Info for CA264_03180 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: efflux transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF00529: CusB_dom_1" amino acids 18 to 334 (317 residues), 34.4 bits, see alignment E=5.3e-12 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 45 to 349 (305 residues), 241.7 bits, see alignment E=4.8e-76 PF13533: Biotin_lipoyl_2" amino acids 72 to 115 (44 residues), 26 bits, see alignment 1.9e-09 PF16576: HlyD_D23" amino acids 74 to 268 (195 residues), 93.9 bits, see alignment E=2.6e-30 PF13437: HlyD_3" amino acids 166 to 266 (101 residues), 68.4 bits, see alignment E=2.4e-22

Best Hits

KEGG orthology group: None (inferred from 41% identity to cts:Ctha_1210)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNR8 at UniProt or InterPro

Protein Sequence (350 amino acids)

>CA264_03180 efflux transporter periplasmic adaptor subunit (Pontibacter actiniarum KMM 6156, DSM 19842)
MKKIIYIVAVLVALGAIGYTLMNNKKEMAATAAIAERKSESIPVALTTPKVGAVDKSFTA
QGNFIPEQDLTLLSETQGQVLKIYKQNGDRVKAGEMLAQVDAQLLRAELVRAQANYTKSK
RDLERFENLAEGDAITKRQLEDARLGFSNAEAALITAKKRLADASIKAPISGRINEKFIE
VGSYLSPGTKLFNIVNVDNLKMNVKVPESQVGLIRDGQKVQIKADAVGGETFEGTVKAIA
AKGDNSLNYNVELQVSNPSDNPLKAGMYGTAYFEVADQRKALLIEREAIVGSLQNPQVFV
VNNGSAFLKDIKVGGTQGNKVEVTGGLEAGDKVVQSGQINLKNGTKVTVL