Protein Info for CA264_03165 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: acyl-CoA desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 transmembrane" amino acids 38 to 59 (22 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 202 to 223 (22 residues), see Phobius details amino acids 229 to 251 (23 residues), see Phobius details PF00487: FA_desaturase" amino acids 66 to 334 (269 residues), 132.7 bits, see alignment E=1e-42

Best Hits

KEGG orthology group: K00508, linoleoyl-CoA desaturase [EC: 1.14.19.3] (inferred from 59% identity to chu:CHU_3762)

Predicted SEED Role

"Linoleoyl-CoA desaturase (EC 1.14.19.3)" (EC 1.14.19.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.19.3

Use Curated BLAST to search for 1.14.19.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNW7 at UniProt or InterPro

Protein Sequence (356 amino acids)

>CA264_03165 acyl-CoA desaturase (Pontibacter actiniarum KMM 6156, DSM 19842)
MAAPKFQTQKQSFHAELKRRTQEYFQTTGISTTGNYKLYTKAIILTLGLLLLYVHLVFFT
PESALLALLECAVLGIITAGIGFNISHDGSHGSFSKIKKLNEMAGMFLNVLGANEFMWNT
KHNVIHHAYTNVDGVDDDLDAGPFLRLCETQKFRKIHRFQHFYFWAAYSLLFFFWVFFSD
YQKYFTKKVGTMPLKKMKASDHIIFWTFKVFHLAFFVALPIYTVGLLPWALGFLVYGLVA
GFVMSIVFQLAHTVRETHFPVVSPVTNKLEDEWAVHQLKTTANFATNNKLVTWFSGGLNF
QVEHHLFPKVSHVHYPALSVIVAQACAEFGIPYHNIPGMRMAVVSHVSYLKQLSRG