Protein Info for CA264_03145 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: cellulose synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 593 transmembrane" amino acids 29 to 46 (18 residues), see Phobius details amino acids 52 to 69 (18 residues), see Phobius details amino acids 341 to 362 (22 residues), see Phobius details amino acids 368 to 392 (25 residues), see Phobius details amino acids 404 to 428 (25 residues), see Phobius details amino acids 447 to 467 (21 residues), see Phobius details amino acids 479 to 501 (23 residues), see Phobius details amino acids 513 to 531 (19 residues), see Phobius details amino acids 542 to 562 (21 residues), see Phobius details PF00535: Glycos_transf_2" amino acids 108 to 259 (152 residues), 53.7 bits, see alignment E=6.2e-18 PF13641: Glyco_tranf_2_3" amino acids 110 to 312 (203 residues), 93.9 bits, see alignment E=3.6e-30 PF13506: Glyco_transf_21" amino acids 147 to 311 (165 residues), 66.1 bits, see alignment E=7.6e-22 PF13632: Glyco_trans_2_3" amino acids 174 to 359 (186 residues), 88.2 bits, see alignment E=1.7e-28 PF03552: Cellulose_synt" amino acids 264 to 387 (124 residues), 37.2 bits, see alignment E=3.5e-13

Best Hits

Predicted SEED Role

"Cellulose synthase catalytic subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNP5 at UniProt or InterPro

Protein Sequence (593 amino acids)

>CA264_03145 cellulose synthase (Pontibacter actiniarum KMM 6156, DSM 19842)
MQLPFFKSPATEQVSAPPLLRRDVRTIRFMIWMGLVTMGLFLYWFIDGDHIGYAPLYWLL
TTALLFKLLRTLHEWYHYYTVSIPERPALRTNFTVDILTTYCPGEPRSMIINTLEAIQNI
RYPHTAYLCDEGDDPMLKAACERLGVVHVTRTEKVDAKAGNINNALKQASGDICLILDPD
HVPQPEFLDEVLPYFEDPEVGFVQVVQGYSNQKESLVAYGAAEQTYSFYGPMMMGMNSYG
TVQAIGANCTFRRKALDSIGGHAAGLSEDMHTAMQLHAKGWKSTYVPKMLTRGLVPATLA
AYYKQQIKWARGTFELLFTVYPKLFRHFTTRQKIHYFTLPLYYLFGLFNLIDFLIPAMAL
VLAEFPWYVSLGEFLVMFTPFFCISICIRHFAQRWYHEKNEKGFHLFGGILRTGTWWVFL
LGLVYSILRIRVPYIPTPKDDKPKNNLLLSLPNILICLLSIGAIAFSQVEYGHLYNNPYV
QMMALFALTNVAIVGSIVVIGQEQFMEWVRRRFLHAAMLQPLLMPLRYAVWRTRHGFYDS
IRYVAVAVVLIATVVSLTFIFGREEVIRYWSAKAPGTSLAPDATAASATHWHR