Protein Info for CA264_03120 in Pontibacter actiniarum KMM 6156, DSM 19842
Annotation: protoporphyrinogen IX oxidase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 43% identical to Y1790_SYNY3: UPF0093 membrane protein slr1790 (slr1790) from Synechocystis sp. (strain PCC 6803 / Kazusa)
KEGG orthology group: K08973, putative membrane protein (inferred from 68% identity to sli:Slin_3572)MetaCyc: 43% identical to protoporphyrinogen oxidase monomer (Synechocystis sp. PCC 6803)
Protoporphyrinogen oxidase. [EC: 1.3.3.4]
Predicted SEED Role
"Protoporphyrinogen IX oxidase, novel form, HemJ (EC 1.3.-.-)" (EC 1.3.-.-)
MetaCyc Pathways
- superpathway of heme b biosynthesis from glutamate (10/10 steps found)
- superpathway of heme b biosynthesis from glycine (7/8 steps found)
- heme b biosynthesis I (aerobic) (4/4 steps found)
- 3,8-divinyl-chlorophyllide a biosynthesis I (aerobic, light-dependent) (4/9 steps found)
- 3,8-divinyl-chlorophyllide a biosynthesis III (aerobic, light independent) (4/9 steps found)
KEGG Metabolic Maps
- 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
- Biosynthesis of alkaloids derived from shikimate pathway
- Limonene and pinene degradation
- Porphyrin and chlorophyll metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.3.-.-, 1.3.3.4
Use Curated BLAST to search for 1.3.-.- or 1.3.3.4
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1X9YNU5 at UniProt or InterPro
Protein Sequence (178 amino acids)
>CA264_03120 protoporphyrinogen IX oxidase (Pontibacter actiniarum KMM 6156, DSM 19842) MSYFYVKALHIIFVVTWFAGLFYIVRLFIYFAEAAEKPEPEKTILQRQLALMQKRLWYGI TWPSAVLTLIFGLSMLYLYGSVPGWLVWKLSFVVGLYVYHFLCHRIFKQQQQGLLKYSST QLRIWNEVATLFLISIVFLVVLKSSLSMLWGILGLILFSAILMLAIRIYKRTREAKNQ