Protein Info for CA264_03110 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 54 to 76 (23 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details amino acids 217 to 241 (25 residues), see Phobius details amino acids 248 to 271 (24 residues), see Phobius details amino acids 280 to 299 (20 residues), see Phobius details PF03547: Mem_trans" amino acids 12 to 297 (286 residues), 83.2 bits, see alignment E=7.1e-28

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 56% identity to wvi:Weevi_0924)

Predicted SEED Role

"Malate permease" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNR9 at UniProt or InterPro

Protein Sequence (303 amino acids)

>CA264_03110 transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MSSFILLFGCLGLGVLLQRVKDFPMNAPLVLNQFIIYISLPALALYFIPEVVLSPAVLLP
VGVAWICFAAAALFFWGLGRMFGWSRKLIGCLILTAGLGNTSFIGFPVVEALYGKEGLKT
AILIDQPGSFMVLSTLGIALAAVFSKGQASAQAIARKIFFFPPFLTFMLALLLNVLNLHF
SEDMKDVFQRLGSTVSPLALVSVGLQLRLERRSRHWGFLALGLAFQLLLAPLLILALYHW
GLGVSGEMVQVCVIEAAMAPMITASIVAASYGLKPRLANMMIGFGIPISFITLAFWYWLV
QGI