Protein Info for CA264_02985 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01408: GFO_IDH_MocA
  • amino acids 18 to 130 (113 residues), 35.3 bits, E=4.1e-12
• PF02737: 3HCDH_N
  • amino acids 20 to 106 (87 residues), 24.3 bits, E=6.8e-09
• PF03447: NAD_binding_3
  • amino acids 24 to 134 (111 residues), 24.9 bits, E=6.9e-09
• PF21135: DRL_cat
  • amino acids 159 to 323 (165 residues), 181.1 bits, E=4.4e-57

Best Hits

KEGG orthology group: None (inferred from 69% identity to cag:Cagg_2145)

Predicted SEED Role

"Homoserine dehydrogenase (EC 1.1.1.3)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 1.1.1.3)

MetaCyc Pathways

• superpathway of L-methionine biosynthesis (by sulfhydrylation) (11/12 steps found)
• superpathway of L-isoleucine biosynthesis I (11/13 steps found)
• L-homoserine biosynthesis (3/3 steps found)
• superpathway of L-threonine biosynthesis (5/6 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (11/15 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (6/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (6/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (5/8 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (12/18 steps found)
• aspartate superpathway (17/25 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.3

Use Curated BLAST to search for 1.1.1.3

Sequence Analysis Tools

See A0A1X9YNM6 at UniProt or InterPro

Protein Sequence (453 amino acids)

>CA264_02985 NAD(P)-dependent oxidoreductase (Pontibacter actiniarum KMM 6156, DSM 19842)
MIIVDTALAKRHAEGNPIRVAMVGAGFMGRGIALQISKYTKGMELVAISNRTLSKARQAY
NQAEIEEVQEVSTLAELEENIRQGKYSVTEDAMLLCEAEGIDAVIEVTGAVEFGTNVAMR
AIQNGKHIIMMNAEVDGTVGPMLKVYADKAGVVFTNADGDQPGVTMNLYRFVKGLGVKPV
LCGNIKGLHDPYRNPTTQEGFAKKWGQQPSMVTSFADGSKISFEQAIIANGTGMRVAKRG
MHGPTVASGTSLKDCVHNLYPLEDLTEGPGIVDYVVGAEPGPGVFVLGTHDNPIQQHYLN
LYKLGEGPLYLFYTPYHLCHFEVPATVARAVLFHDAALTPVGAPQVAVVSAAKIDLKAGE
VLDGIGHYMTYGLCENADTTAAERLLPIGVAEGCVLKRDIPKDQVITYDDVVLPEGRLVD
RLLEQQAAYFAASDDAERERVLQGFSNATASVS