Protein Info for CA264_02980 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: dTDP-4-dehydrorhamnose 3,5-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 41% identical to RMLC_SINFN: dTDP-4-dehydrorhamnose 3,5-epimerase (NGR_a03520) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K01790, dTDP-4-dehydrorhamnose 3,5-epimerase [EC: 5.1.3.13] (inferred from 64% identity to cyh:Cyan8802_2785)

Predicted SEED Role

"dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13)" in subsystem Capsular heptose biosynthesis or Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 5.1.3.13)

MetaCyc Pathways

dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
dTDP-4-O-demethyl-β-L-noviose biosynthesis (4/5 steps found)
O-antigen building blocks biosynthesis (E. coli) (8/11 steps found)
dTDP-L-daunosamine biosynthesis (3/6 steps found)
dTDP-sibirosamine biosynthesis (3/6 steps found)
superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (7/19 steps found)
superpathway of novobiocin biosynthesis (4/19 steps found)
superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (10/33 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.13

Use Curated BLAST to search for 5.1.3.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNQ9 at UniProt or InterPro

Protein Sequence (187 amino acids)

>CA264_02980 dTDP-4-dehydrorhamnose 3,5-epimerase (Pontibacter actiniarum KMM 6156, DSM 19842)
MIFTETKLKGAFIIDVKRLEDERGFFGRSFCQKEFEEHGLSNDVRQTNVSYNKKKGTLRG
MHMQLAPNEESKLVRCTRGAIYDVIIDMRPGSETYKQWIGVELTADNYRMLFVPEGFAHG
FITLEDNTDVTYQVTEFYTPGAERGIRWNDPAFNIEWPIEPVVISEKDQAHPDFVDEQEK
STGKLLV