Protein Info for CA264_02960 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 transmembrane" amino acids 182 to 197 (16 residues), see Phobius details amino acids 226 to 245 (20 residues), see Phobius details TIGR00696: glycosyltransferase, WecB/TagA/CpsF family" amino acids 55 to 233 (179 residues), 161.1 bits, see alignment E=1.2e-51 PF03808: Glyco_tran_WecG" amino acids 60 to 229 (170 residues), 188.6 bits, see alignment E=3.9e-60

Best Hits

KEGG orthology group: K05946, N-acetylglucosaminyldiphosphoundecaprenol [EC: 2.4.1.187] (inferred from 46% identity to dba:Dbac_1003)

Predicted SEED Role

"N-acetylmannosaminyltransferase (EC 2.4.1.187)" in subsystem Teichoic and lipoteichoic acids biosynthesis (EC 2.4.1.187)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.187

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YXN1 at UniProt or InterPro

Protein Sequence (257 amino acids)

>CA264_02960 glycosyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKEKRQLLSSLISAGTFEDFVNQVFWLTDNKESSYVCFANVHMLMEARNDKDFQDLLNNA
DIASPDGGPLSKLMKLLYGQHQDRVPGMDLMPRLLQEAAVRGKSVYFYGSTDDVLEAVVA
QAKKDLPDLRIAGHYSPPFRKLTHIEDTAITKMINDSGADLVFVALGCPKQERWMADHKG
QVKACMLGVGQAYMTYAGLERRLPKWARDLSLEWTYRLWQEPRRLWKRYLVTNTLFLFEV
AKLMLSKRSNRRLQLTK