Protein Info for CA264_02925 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1125 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 203 to 221 (19 residues), see Phobius details PF12729: 4HB_MCP_1" amino acids 25 to 192 (168 residues), 43.3 bits, see alignment E=1.2e-14 TIGR00229: PAS domain S-box protein" amino acids 251 to 374 (124 residues), 53.6 bits, see alignment E=1.2e-18 amino acids 681 to 756 (76 residues), 24.9 bits, see alignment 9.2e-10 amino acids 761 to 884 (124 residues), 44.5 bits, see alignment E=7.7e-16 PF00989: PAS" amino acids 256 to 345 (90 residues), 23.6 bits, see alignment E=1.7e-08 amino acids 764 to 865 (102 residues), 28.7 bits, see alignment E=4.5e-10 PF13426: PAS_9" amino acids 264 to 352 (89 residues), 28.3 bits, see alignment E=7.2e-10 amino acids 780 to 877 (98 residues), 25.8 bits, see alignment E=4.4e-09 PF08447: PAS_3" amino acids 408 to 488 (81 residues), 31.8 bits, see alignment 5.8e-11 amino acids 657 to 743 (87 residues), 47.8 bits, see alignment 5.9e-16 amino acids 786 to 871 (86 residues), 52.2 bits, see alignment 2.4e-17 PF00512: HisKA" amino acids 899 to 958 (60 residues), 28.8 bits, see alignment 4.3e-10 PF02518: HATPase_c" amino acids 1013 to 1115 (103 residues), 62 bits, see alignment E=2.8e-20

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNP9 at UniProt or InterPro

Protein Sequence (1125 amino acids)

>CA264_02925 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MLKMERTRKIESDASRRRTIQFIGISFVSLVVLLFSVCLFSYIKANQVQQEYSIKLQQAY
KRLELVNELFSNKELSQNLVREHVYTRDRALKKAVRQQLEQSHEDNRAIVDKLETLLQQK
ERKALLRELAQERSSYYSHVDSLLELSESNRTQEAQAYTGAYLAPFYSKQQTLLIRLSNE
ATESSQKRTKEAIQASSSIVDSYSFLLILAVGAAVGAAYMLSRVFRRLRLENELLNAEVL
ERQELQQALLDSQQAYRRLFDRNPVPMWVYDQHSLKFMEVNEAAIKEYGYNREEFLAMSI
LDIRPDGEKEKIQRRMLHIDKAADATSYDFVHMRKDGSTFKVELKSHALPERADSYPRLV
VSVNVQEREETMAKLEKNEQQLREVSSSIPGAVYQFLVDTEGRESYPFISDGVFELYGVT
AEEAYQDADRLFAPVHPDDQKAIAHATEISTRDLTPWLAEFRVWHPKQCKWKWIRGHGLP
TLKPDGSVLSNGTLIDITSQKEAQAQLVASEANLRTLLDSSSQSIYLLNKKRELVAFNKA
AEEEVKKHLLKPLRKGQDLLSFVDQAQQQQFFENHLTAMQGQAVLYEQGSGDYWYEIAFK
PVFDSTEKVIGVTLSIHDRSEQKKAIEVIKKNEAQLAKAQQIAKLGSWEYDLAKDMLTIS
RNLYDIYELPYKTFTPTFRNIAARFYPDDRARVLEQYQQALATRSDLISEHRIVTESGQV
KYLAQIGEVVCDEEGKPVKVAGTTQDITDRKRSEREVIETKNLLQSTIGNIPEIIFSADG
TLKLNYLSPKCREITGFTEQELLENDNHWLSMVHDADKEALLQLVVPKLKAGVKTNQEVC
ITTRDGQTKWLLLRISPMLDANGQLVRVDGSASDMTQYKEAEQKKQQLTEQLVKQNQNLQ
QFAYIVSHNLRTPIANMLGLASIYDQENPHAPVNGRVVDNLVKSAQLLDTTIRDLNELLT
VRSQAEAVQEQVDFHHLLEEVCVALEKEIAQSGASVSCSFEDAPSVVTVKSFASSIMFNL
VCNAIKYRHPERKPRVDVTTYRVNGYLCLQIQDNGLGIDLERQRDKVFGLYKRFHPKIEG
KGIGLHLVKTQTELLGGKVEVESQPNLGTTFRVYFTQLQYHEHPK