Protein Info for CA264_02815 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ketoacyl reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 37 to 221 (185 residues), 194.2 bits, E=3.5e-61
• PF08659: KR
  • amino acids 39 to 193 (155 residues), 76.7 bits, E=4.5e-25
• PF13561: adh_short_C2
  • amino acids 46 to 223 (178 residues), 131 bits, E=1.1e-41

Best Hits

KEGG orthology group: None (inferred from 52% identity to sur:STAUR_2184)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (48/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (17/20 steps found)
• biotin biosynthesis I (13/15 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (13/16 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
• (5Z)-dodecenoate biosynthesis I (5/6 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• fatty acid elongation -- saturated (4/5 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
• palmitate biosynthesis III (21/29 steps found)
• (5Z)-dodecenoate biosynthesis II (4/6 steps found)
• stearate biosynthesis II (bacteria and plants) (4/6 steps found)
• anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• petroselinate biosynthesis (3/6 steps found)
• stearate biosynthesis IV (3/6 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• tetradecanoate biosynthesis (mitochondria) (12/25 steps found)
• mycolate biosynthesis (23/205 steps found)
• superpathway of mycolate biosynthesis (24/239 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

See A0A1X9YNI5 at UniProt or InterPro

Protein Sequence (339 amino acids)

>CA264_02815 ketoacyl reductase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKANNKNTFWWMAAGTGALLAARAVRRKLNAYDFNGKVVLITGGSRGLGLVMARQLAQEG
ARLVLCARDKDELENARMELAGKGANVLVQKCDVTDQQQVQDVVTNVLNEFGPIDVLINN
AGIIHAGPVTEMTVQEFDEAIKTHYWGPVHTILAVLPSMKARGEGRILNVSSIGGKISVP
HLVPYSASKFALVGLSEGLRAELDKYNIIVTTATPGLIQTGSPRHAIVKGHHKEEYALFK
LMDSSPLTSMSAEATAKKILDGLRHGDTQVTTTIPAKLGALLHGLSPSFVTSVFGLVNKV
LPGEGGIGKERVRGYESESRLSQSGLTERTQKAAEKNNE