Protein Info for CA264_02750 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: RNA-binding transcriptional accessory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 756 PF09371: Tex_N" amino acids 11 to 194 (184 residues), 250.1 bits, see alignment E=3.7e-78 PF16921: Tex_YqgF" amino acids 318 to 440 (123 residues), 167.2 bits, see alignment E=6.8e-53 PF14635: HHH_7" amino acids 454 to 546 (93 residues), 38.3 bits, see alignment E=4.4e-13 PF12836: HHH_3" amino acids 481 to 545 (65 residues), 103.4 bits, see alignment E=1.8e-33 PF17674: HHH_9" amino acids 551 to 620 (70 residues), 95.5 bits, see alignment E=8.2e-31 PF00575: S1" amino acids 639 to 710 (72 residues), 82.2 bits, see alignment E=8.6e-27

Best Hits

KEGG orthology group: K06959, uncharacterized protein (inferred from 70% identity to psn:Pedsa_3527)

Predicted SEED Role

"Transcription accessory protein (S1 RNA-binding domain)" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNJ0 at UniProt or InterPro

Protein Sequence (756 amino acids)

>CA264_02750 RNA-binding transcriptional accessory protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MEPNLEHLLKIASELSITIKQVEATARLLDEGATVPFISRYRKEATGSLDEVQIAGVRDR
LEQLRELDKRRESILKSIRDQEKLTPELEAQIMAAETMAALEDIYLPYKPKRRTRATIAR
EKGLEPLAERLFQQESFDVEAEASNFISEEKEVKDVNEALSGARDIMAEWMNENAEARAA
IRQIFEKQGVFKSRVMMGKEEEGQKFKDYFEWEEPIEKAPSHRILAMRRGETEMVLMLTA
QPDEEAALAKLEDMFVQGSNAASEQVRLAARDCYKRLLKLSMETEVRLSSKKRADEEAIR
VFADNLRQLLLSSPLGQKTVLALDPGFRTGCKLVVLDKQGKLLHNETIYPHTGQGKAMEA
AQNVKYLVDRFEVEALAIGNGTASRETEAFVKGLNLPKTVQVVMVNESGASIYSASEVAR
EEFPDQDVTVRGAVSIGRRLMDPLAELVKIDPKSIGVGQYQHDVDQSALKHSLDDVVMSC
VNAVGVEVNTASKQLLTYVSGLGPALAQNIVEYRNQNGPFKTRTELKKVARLGDKAFEQA
AGFLRIRDAKNPLDASAVHPESYPIVEQMAKDLGVTVQDLIKSDELRKKINLKNYVTDTV
GLPTLQDIISELAKPGRDPRETFEAFSFTEGVNEIKDLRAGMKLPGIVTNITAFGAFVDI
GVHQDGLVHVSHLSDRFVSNPHEVVKVGQKVEVTVLEVDEARKRISLSMKGDPAAAKPAG
GGSRGNNSNKGGRKEREEEPMDDFQAKLAKLKGMFK