Protein Info for CA264_02745 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: mechanosensitive ion channel protein MscS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 transmembrane" amino acids 27 to 46 (20 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 112 to 130 (19 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 196 to 264 (69 residues), 59.5 bits, see alignment E=1.4e-20

Best Hits

KEGG orthology group: None (inferred from 53% identity to rbi:RB2501_10842)

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNI6 at UniProt or InterPro

Protein Sequence (441 amino acids)

>CA264_02745 mechanosensitive ion channel protein MscS (Pontibacter actiniarum KMM 6156, DSM 19842)
METANHFSRIGHWTTAYLTDMGMPLNVAVYVNMLLLLALLLLLLYTSKIATRTALRGTAH
RFAAKTSTQFDDYLIQNRVFSLIAQAVPLVIVVQALPIVFADFEAWIKPLRTLVDAYIVL
LSIWTLQALLRTCRDFMKTTALFKDKPVDSFVQVLTIFLYFVGGLLIFSLLTGKSVWAFI
TAMGAASAILLLVFKDTILGFVASIQVSTNDMVRIGDWITMEKYGADGTVVEINLTTVKV
QNFDMTITTIPTYYLISDSFINWRGMQAAGGRRIKRSIHIKISSIKYLSEEDVQRLSKIG
LVSEYLQERQQEIAAYNKAKHVDKHLLINGRSLTNIGVFRRYIDAYIQQHEFTHKHMTMM
VRQLEPTTTGMPIELYVFTNEVRWEKYELIMADIFDHLLAAVRYFDLEVFEYPAADDVRQ
LFGKPGTDKNSLYAAMEAMKN