Protein Info for CA264_02625 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 523 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 43 to 67 (25 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 203 to 222 (20 residues), see Phobius details amino acids 265 to 287 (23 residues), see Phobius details amino acids 307 to 327 (21 residues), see Phobius details amino acids 346 to 376 (31 residues), see Phobius details amino acids 396 to 427 (32 residues), see Phobius details PF00916: Sulfate_transp" amino acids 14 to 383 (370 residues), 185.7 bits, see alignment E=6e-59

Best Hits

KEGG orthology group: None (inferred from 55% identity to dfe:Dfer_2931)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNG4 at UniProt or InterPro

Protein Sequence (523 amino acids)

>CA264_02625 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MKEETNNFGYLSNLSKDIPSGLVVFFVALPLCLGISLASGAPLLSGVITGIVGGVVVAWL
SGSQLAVSGPAAGLTVIVLNGIETLGSFELFLLAVLIAGILQLGLGFMKAGVIGLYFPSS
VIKGMLAAIGLILILKQIPHFVGADEDFFGEMMFFQPDGRNTFSEIGYAFSKIQLGALIV
GIVSLAVILLWDNPKVKSNKYLKLIPGALLAVVLAIILNVVFNNYVPALAIADSHLVNLP
VLESFSDIKSEVAFMDLSGLTNPSLYIVAFTIAIVASLETLLSIEAIDKLDPHKRRSDTN
RELKAQGVGNIVASLLGGLPMTAVIVRGSTNVAAGAQTRVSSFVHGVFLALSVFLLANLM
NLIPLSALAAVLLVVGFKLTKPALYKTQFKLGLDQFIPFVVTVLAILFTDLLIGICVGLA
VGVFYILKANYKSPYFYHKEEHRDRDIIRIKLSEHVSFLNKASIILTLDHLPHDSHVIID
GENSAFIDYDVVEAIQEFKKTAHERNIQVELINIQDVAVLDMH