Protein Info for CA264_02620 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: two-component sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details PF00672: HAMP" amino acids 175 to 226 (52 residues), 45.2 bits, see alignment 1.4e-15 PF00512: HisKA" amino acids 232 to 293 (62 residues), 49.3 bits, see alignment E=6.3e-17 PF02518: HATPase_c" amino acids 347 to 454 (108 residues), 75.2 bits, see alignment E=8.5e-25

Best Hits

KEGG orthology group: K07644, two-component system, OmpR family, heavy metal sensor histidine kinase CusS [EC: 2.7.13.3] (inferred from 39% identity to sli:Slin_0731)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNI1 at UniProt or InterPro

Protein Sequence (465 amino acids)

>CA264_02620 two-component sensor histidine kinase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKIRSKLTLQFASIMTVILVLFSLVVYYFTSLYRQDDFYMRIFRRAQVAAQHILEADEVS
KQQREQNQINFYHELPYEAVRIYRTNGELLFSKGKGNLGVTQAELDKIAQRGSVEYEQGV
RQVVGIRYKDNQGDFIVLASSVDAYSLRKLQHLKIILIVGFLGSMGVVLVAGWVFSKQAM
RPITKVVSEVEKISANDLHLRLSNADGKDEVSHLAQTFNKMLDRLELAFEMQSTFVSNAS
HELRTPLTAMIGELEVALMKSREPEEYRRVLQSTLEDARLLTELSNGLLQIAQASLDPSK
IKLAYLRFDELVWMAREQVLKRQPNARIDIDFANFPEDEDRLVVRGNEALLLIAVVNVLE
NALKFSPNGQVATGQIDVQDHEVLLRVQDRGLGISQEDLKHVFVPFFRAENVRNITGHGI
GLPLTERILKLHKGAICVHSQINKGTEVTITLRQAYATIPTFPRL