Protein Info for CA264_02615 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: DNA-binding response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 PF00072: Response_reg" amino acids 3 to 113 (111 residues), 106.7 bits, see alignment E=7.6e-35 PF00486: Trans_reg_C" amino acids 146 to 221 (76 residues), 87.3 bits, see alignment E=5.8e-29

Best Hits

Swiss-Prot: 47% identical to COPR_PSEUB: Transcriptional activator protein CopR (copR) from Pseudomonas syringae pv. tomato

KEGG orthology group: K07665, two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR (inferred from 62% identity to sli:Slin_2929)

Predicted SEED Role

"DNA-binding heavy metal response regulator" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNM1 at UniProt or InterPro

Protein Sequence (227 amino acids)

>CA264_02615 DNA-binding response regulator (Pontibacter actiniarum KMM 6156, DSM 19842)
MKILLIEDEPKVASFIKKGLEEQTYEVEQAYDGTFGIKLALQHEYDLIILDIILPNMSGL
DVCREIRRHNKTVSVLMLTALGTTDDKIIGLDAGADDYLTKPFEFKELLARIRALSRRTS
EGATGEKIRIADLEMDVAKKTVTRGGKPVNLTAREFSLLHYLLRNQGRVVSRVDITEQVW
ETSFDTGSNVIDVYINFLRKKIDKAHDTKLIHTLVGMGYVLKEQDNA