Protein Info for CA264_02610 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: cation transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 25 to 44 (20 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 123 to 142 (20 residues), see Phobius details amino acids 162 to 179 (18 residues), see Phobius details amino acids 185 to 201 (17 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 22 to 292 (271 residues), 228.5 bits, see alignment E=5e-72 PF01545: Cation_efflux" amino acids 24 to 212 (189 residues), 152.8 bits, see alignment E=5.1e-49

Best Hits

Swiss-Prot: 35% identical to CZCD_BACVZ: Cadmium, cobalt and zinc/H(+)-K(+) antiporter (czcD) from Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / FZB42)

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 57% identity to mtt:Ftrac_1213)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNG3 at UniProt or InterPro

Protein Sequence (303 amino acids)

>CA264_02610 cation transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MAHAHHNHQGGHGHHHHGASDNIKVAFFLNLAFTILEIFGGLWINSVAILSDALHDLGDS
LSLGLAWYFEKLSKRGRNKKFTFGYKRFSLLGAVINSVVLLVGSFFILSEAVPRIWDPQE
VNAPGMMGFAVLGIIANGAAVLRLQGGASLNERVVRLHLMEDVLGWVAVLIGGVILYFFD
VPWIDPLLSVCITLYVLYNVVRNLRETMTILLQASPPHINTQDVEARLESIDDIRSVHDL
HIWTLDGTYNVLSMHAVVKEELPMQQAKELKKRVRTAMSDMDIQHVTMELESPGEECTHQ
SKI