Protein Info for CA264_02560 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: DUF4153 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 transmembrane" amino acids 64 to 85 (22 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 186 to 212 (27 residues), see Phobius details amino acids 219 to 240 (22 residues), see Phobius details amino acids 252 to 274 (23 residues), see Phobius details amino acids 285 to 305 (21 residues), see Phobius details amino acids 316 to 340 (25 residues), see Phobius details amino acids 352 to 373 (22 residues), see Phobius details amino acids 388 to 413 (26 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 55% identity to sli:Slin_6580)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNG8 at UniProt or InterPro

Protein Sequence (414 amino acids)

>CA264_02560 DUF4153 domain-containing protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MKEEILIHLNDPGQLEKLYRSNKAPFKRAFSMVYPELKGNTLADCWNERLQYESDEINWG
STTELLLVVAAALTAGFIAKIPALFHVSEAFFYPRNAGFIFLPLLAAYFAWKNNLPPQRI
AVLGGVMLLSLIYINALPASTESDTLLLACIHLLLLLWVLLGAAYAGQDLNSYDKRLDYL
RYNGDLLVMTTLILIAGGIMTGLTIGLFSLIGFQIEELYFQYVGIFGLAGAPIVGTYLTQ
TNPQLVNKVSPVIARIFGPLVLAMLVVYLGAIVYSGKDPYNDREFLLLFNLLLIGVMAIV
FFSVAENSRAARNTTAAWVLLLLSVVTILVNSIALSAILFRIAEWGFTPNRLAVLGGNIL
ILANLLLVTFGLYRSVTRKADTAAVGRAIAAYAPVYGAWVVVVVFLFPLLFGFR