Protein Info for CA264_02550 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: phosphoadenosine phosphosulfate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00434: phosophoadenylyl-sulfate reductase
  • amino acids 30 to 237 (208 residues), 173.9 bits, E=4.3e-55
• PF01507: PAPS_reduct
  • amino acids 37 to 212 (176 residues), 163.9 bits, E=2e-52
• TIGR02055: adenylylsulfate reductase, thioredoxin dependent
  • amino acids 43 to 236 (194 residues), 248.9 bits, E=3.5e-78

Best Hits

Swiss-Prot: 51% identical to CYSH_BURCE: Thioredoxin-dependent 5'-adenylylsulfate reductase (cysH) from Burkholderia cepacia

KEGG orthology group: K00390, phosphoadenosine phosphosulfate reductase [EC: 1.8.4.8] (inferred from 67% identity to dfe:Dfer_2615)

MetaCyc: 51% identical to assimilatory adenylyl-sulfate reductase (Allochromatium vinosum)
Adenylyl-sulfate reductase (glutathione). [EC: 1.8.4.9]

Predicted SEED Role

"Phosphoadenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.8) / Adenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.10)" in subsystem Cysteine Biosynthesis (EC 1.8.4.10, EC 1.8.4.8)

MetaCyc Pathways

• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (11/12 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (9/10 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• assimilatory sulfate reduction IV (4/4 steps found)
• assimilatory sulfate reduction II (3/3 steps found)
• assimilatory sulfate reduction III (3/3 steps found)
• selenate reduction (2/5 steps found)
• superpathway of seleno-compound metabolism (7/19 steps found)

KEGG Metabolic Maps

• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.10 or 1.8.4.8 or 1.8.4.9

Sequence Analysis Tools

See A0A1X9YND8 at UniProt or InterPro

Protein Sequence (239 amino acids)

>CA264_02550 phosphoadenosine phosphosulfate reductase (Pontibacter actiniarum KMM 6156, DSM 19842)
MDLSQELLAKLDSLRASLTGLSAEEGLQRLAQEFNGNIAFSSSLGIEDQVITHFIFENNL
PIRVFTLDTGRLFNESYTLLHKTNNHYGKKIEVYFPKHEAVEQLVNEKGPMSFYNSIDDR
KQCCYIRKVEPLNRALQGVNIWVTGIRADQSGARQDLQLLEWDEGHQLIKYNPLLDWSLE
DVKAAVKTLNIPYNPLHDKGFVSIGCAPCTRAIAEGEDFRAGRWWWEDNSKKECGLHAR