Protein Info for CA264_02540 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: sulfate adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00009: GTP_EFTU
  • amino acids 2 to 201 (200 residues), 153.5 bits, E=7.4e-49
• TIGR02034: sulfate adenylyltransferase, large subunit
  • amino acids 4 to 413 (410 residues), 568.7 bits, E=7.5e-175
• TIGR00231: small GTP-binding protein domain
  • amino acids 9 to 189 (181 residues), 43.2 bits, E=3.6e-15

Best Hits

Swiss-Prot: 54% identical to CYSN_CELJU: Sulfate adenylyltransferase subunit 1 (cysN) from Cellvibrio japonicus (strain Ueda107)

KEGG orthology group: K00956, sulfate adenylyltransferase subunit 1 [EC: 2.7.7.4] (inferred from 61% identity to sli:Slin_1693)

MetaCyc: 55% identical to sulfate adenylyltransferase large subunit (Allochromatium vinosum)
Sulfate adenylyltransferase. [EC: 2.7.7.4]

Predicted SEED Role

"Sulfate adenylyltransferase subunit 1 (EC 2.7.7.4)" in subsystem Cysteine Biosynthesis (EC 2.7.7.4)

MetaCyc Pathways

• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (11/12 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (9/10 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• assimilatory sulfate reduction IV (4/4 steps found)
• assimilatory sulfate reduction II (3/3 steps found)
• assimilatory sulfate reduction III (3/3 steps found)
• sulfate activation for sulfonation (2/2 steps found)
• sulfite oxidation III (1/3 steps found)
• selenate reduction (2/5 steps found)
• dissimilatory sulfate reduction I (to hydrogen sufide)) (1/5 steps found)
• superpathway of sulfur metabolism (Desulfocapsa sulfoexigens) (1/6 steps found)
• superpathway of thiosulfate metabolism (Desulfovibrio sulfodismutans) (1/6 steps found)
• superpathway of sulfide oxidation (phototrophic sulfur bacteria) (3/12 steps found)
• superpathway of seleno-compound metabolism (7/19 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.4

Use Curated BLAST to search for 2.7.7.4

Sequence Analysis Tools

See A0A1X9YNE7 at UniProt or InterPro

Protein Sequence (418 amino acids)

>CA264_02540 sulfate adenylyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MDILRFITAGSVDDGKSTLIGRLLYDTKQIFADQLEAIESSGRLNEDGQVDLSLLTDGLK
AEREQGITIDVAYKYFSTEKRKFIIADAPGHIQYTRNMVTGASNSNLSIILVDARKGVQE
QTRRHSIISSLLGIPHLVICINKMDLVGYDEQVYNQIIADYKQFAKKLNAKDITFIPVSA
LKGDNIVEGSELTMPWYQGPSLLEHLEQVPVSQDFNLDDSRFPVQYVIRPLTAEHHDYRG
YAGKVISGTYKAGDKVTVQPSGQTTTVKSVELGGKVLEEAFAPMSVVLQLEDEVDISRGD
IIVKAAENLEVAQEFEATVCWMHNKALKPGAKLLLRHNSTETRCVVRNIDYKIDINTLDH
LEDVDQIQLNDICRVQIKTASPLLLDKYEDNRSNGGFILVDETSFATVGAGMVSEIEF