Protein Info for CA264_02525 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: siroheme synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 transmembrane" amino acids 220 to 245 (26 residues), see Phobius details amino acids 265 to 288 (24 residues), see Phobius details amino acids 294 to 295 (2 residues), see Phobius details amino acids 301 to 312 (12 residues), see Phobius details amino acids 333 to 353 (21 residues), see Phobius details amino acids 359 to 382 (24 residues), see Phobius details amino acids 394 to 416 (23 residues), see Phobius details amino acids 434 to 476 (43 residues), see Phobius details amino acids 486 to 507 (22 residues), see Phobius details TIGR01470: siroheme synthase, N-terminal domain" amino acids 26 to 195 (170 residues), 108.6 bits, see alignment E=1.7e-35 PF13241: NAD_binding_7" amino acids 28 to 140 (113 residues), 90 bits, see alignment E=1.4e-29 PF01925: TauE" amino acids 269 to 502 (234 residues), 130.1 bits, see alignment E=1.1e-41

Best Hits

Predicted SEED Role

"Siroheme synthase / Precorrin-2 oxidase (EC 1.3.1.76) / Sirohydrochlorin ferrochelatase (EC 4.99.1.4)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.3.1.76, EC 4.99.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.76 or 4.99.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNE6 at UniProt or InterPro

Protein Sequence (509 amino acids)

>CA264_02525 siroheme synthase (Pontibacter actiniarum KMM 6156, DSM 19842)
MDNLQDDNITLSPAAPVAVEAANPLFPVFLKLEELHTLVVGGGAVGLEKLSAILANSPKA
QVRLVAPEIHVDIWALVAKHPQVELVVREFQENDLADKDIVLIATDDHVLNKAIRDLAKS
RKILTNVADTPQQCDFYLGSVVQKGSLKFGISTNGKSPTVAKRVKEVLHEAFPEEIDQVL
GKMGKIRAQLNGDFAEKVKQLNTLTEGLVRPVPKKKARFSLTSVLVTLFAAIALMITGHL
LFTYIPLQSIGNAAMDVAGQIDSDILVFILAGFVAQLIDGALGMAYGVSATTFLLSFGVS
PVAASASVHASEIFTSGVSGWMHLKFGNVNSKLFKNIVLPGVLGAILGAYLLFSFEEYLF
IIKPIVALYTLVLGILILRKVLRKKVKKQPVKRLGFLATAGGFLDAIGGGGWGPIVSSTL
IAKGRNPMYTIGSVNLAEFFVSIASSATFVAFAGISHWQVILGLILGGSISAPIGARLAR
KLPVKTMMIIVGIVVIIVSLRLIVMALPF