Protein Info for CA264_02520 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: uroporphyrinogen-III C-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 PF00590: TP_methylase" amino acids 27 to 233 (207 residues), 147.4 bits, see alignment E=2.9e-47 TIGR01469: uroporphyrinogen-III C-methyltransferase" amino acids 27 to 260 (234 residues), 281.6 bits, see alignment E=2.9e-88

Best Hits

Swiss-Prot: 43% identical to SUMT_SYNY3: Uroporphyrinogen-III C-methyltransferase (cobA) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02303, uroporphyrin-III C-methyltransferase [EC: 2.1.1.107] (inferred from 62% identity to shg:Sph21_3191)

Predicted SEED Role

"Uroporphyrinogen-III methyltransferase (EC 2.1.1.107)" in subsystem Coenzyme B12 biosynthesis or Dissimilatory nitrite reductase or Experimental tye or Heme and Siroheme Biosynthesis (EC 2.1.1.107)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.107

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNH9 at UniProt or InterPro

Protein Sequence (278 amino acids)

>CA264_02520 uroporphyrinogen-III C-methyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MASRRKEIRAIAAGAQQTGLAKYKLPRLTLVGAGPGDEDLITLKGVKALQQADVVLYDAL
VNPELLQYAPAHAPKIFVGKRAGAHYLKQDEINNLIVDSAFSHGHVVRLKGGDSFVFGRG
YEELAYADKFNIQTEVVPGISSSIAVPELQQIPLTIRGVNESFWVITGTTSSGEISSDVS
LAAQSSATVIILMGVSKLQQISEIYTAAGKADMPVAVIQNGSLPNEKIALGNVHNIMERV
EAKNVGAPAIIVIGEVVNYHPALRYTLALQKQQELVAV