Protein Info for CA264_02485 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: polyprenyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 49 to 71 (23 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 116 to 134 (19 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 169 to 186 (18 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 225 to 245 (21 residues), see Phobius details amino acids 254 to 273 (20 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details PF01040: UbiA" amino acids 32 to 239 (208 residues), 71.1 bits, see alignment E=4.5e-24

Best Hits

KEGG orthology group: K03179, 4-hydroxybenzoate octaprenyltransferase [EC: 2.5.1.-] (inferred from 56% identity to cyt:cce_4454)

Predicted SEED Role

"FIG00557539: hypothetical protein"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNH3 at UniProt or InterPro

Protein Sequence (302 amino acids)

>CA264_02485 polyprenyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MTKVGAYLRLMRPANIVTAIADIMLGYAASGALLSLSLWENGFEAANLYLLGWLVLATIG
LYGGGVVFNDVFDAELDRVERPERPIPSGRASLAGASILGLVLLVGGVLAAWQVSVASAA
IALAVALLALLYDWKGKHHTFLGPINMGACRGGNLLLGVSAIPAAIEDLWFIALIPIVYI
AAITMVSRGEVHGGNTAALKGAVAMYALVFAGIISLALLPQFNLLYSLPFLLLFAFLIFP
PLLKALPAREPKLIIKAVKAGILALIVMNASIAAGFAGWQYGLIVLLLLPVSIYIAKSFA
VT