Protein Info for CA264_02480 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: 3-dehydroquinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 transmembrane" amino acids 113 to 134 (22 residues), see Phobius details PF01761: DHQ_synthase" amino acids 82 to 325 (244 residues), 239.2 bits, see alignment E=6.7e-75 PF13685: Fe-ADH_2" amino acids 92 to 240 (149 residues), 28.3 bits, see alignment E=2.3e-10

Best Hits

KEGG orthology group: K01735, 3-dehydroquinate synthase [EC: 4.2.3.4] (inferred from 59% identity to ana:all0417)

Predicted SEED Role

"3-dehydroquinate synthase (EC 4.2.3.4)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Type IV pilus (EC 4.2.3.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.3.4

Use Curated BLAST to search for 4.2.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNC9 at UniProt or InterPro

Protein Sequence (392 amino acids)

>CA264_02480 3-dehydroquinate synthase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKTIEQNFAVPFRYGVYFTENLFAPSNQVLADVLAQDRASGPRKVMFVVDSGVAEAHPQL
LEHIHHYTLAHPDALQQVAAPLVLPGGEEAKNSKEHLQAILSSINKFGVCRHSYLIAIGG
GAVLDLAGFAAAIAHRGIRHIRVPSTVLSQNDSGVGVKNGINAFGKKNFLGTFAPPFAVI
NDSNFLLTLEDRDWRSGISEAVKVALIKDAAFYQRIKQDAGKLAQRDMEAMQQLIHRCAE
LHVEHIGGPDPFELGSSRPLDFGHWAAHKLEQLSKYSLRHGEAVAIGIALDVVYSQLQGL
LTEAEQDDVLDLLQELGFELFTPELAQQTPDGQLAVIQGLREFREHLGGELTIMLLRQIG
VGEEVHHVDEHLVQQAIALLQKKRQPQPLSQV