Protein Info for CA264_02460 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: sugar dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 PF00106: adh_short" amino acids 12 to 213 (202 residues), 198.9 bits, see alignment E=9.1e-63 PF08659: KR" amino acids 15 to 185 (171 residues), 60.9 bits, see alignment E=2.4e-20 PF13561: adh_short_C2" amino acids 18 to 262 (245 residues), 236.3 bits, see alignment E=5.7e-74

Best Hits

Swiss-Prot: 46% identical to DHG_BACSU: Glucose 1-dehydrogenase (gdh) from Bacillus subtilis (strain 168)

KEGG orthology group: K00034, glucose 1-dehydrogenase [EC: 1.1.1.47] (inferred from 56% identity to hoh:Hoch_0357)

MetaCyc: 46% identical to glcDH (Bacillus subtilis)
Glucose 1-dehydrogenase. [EC: 1.1.1.47]

Predicted SEED Role

"Glucose 1-dehydrogenase (EC 1.1.1.47)" in subsystem D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway (EC 1.1.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.47

Use Curated BLAST to search for 1.1.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YND4 at UniProt or InterPro

Protein Sequence (269 amino acids)

>CA264_02460 sugar dehydrogenase (Pontibacter actiniarum KMM 6156, DSM 19842)
MTYKASDRLAGKVAVVTGASSGIGQGIAIAMGQAGAKVVINYHSDAAGARQTQQQIEKAG
GEAIIRQADVAKPEEAQELIEAAKEQFGAVDILVNNAGVQQDQAFLEMTLEEWKKVIDTN
LTGHFLCAQAAAREFAKRQVKQEEKTCAGNIIFISSVHDIIPWAGRANYTAAKGGLQMLM
KTLAQELAKYKIRVNAISPGAIKTDINRKEWESEEGRKKMLAQIPYGRIGEPEDIAKVAL
WLATDEADYITGSTIYVDGGMTLFPSFSE