Protein Info for CA264_02440 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: vitamin K epoxide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 transmembrane" amino acids 71 to 91 (21 residues), see Phobius details amino acids 116 to 133 (18 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 217 to 240 (24 residues), see Phobius details amino acids 266 to 285 (20 residues), see Phobius details amino acids 297 to 318 (22 residues), see Phobius details amino acids 324 to 346 (23 residues), see Phobius details amino acids 399 to 426 (28 residues), see Phobius details amino acids 438 to 457 (20 residues), see Phobius details amino acids 464 to 481 (18 residues), see Phobius details amino acids 487 to 505 (19 residues), see Phobius details PF07884: VKOR" amino acids 217 to 344 (128 residues), 75.4 bits, see alignment E=2.5e-25

Best Hits

KEGG orthology group: None (inferred from 63% identity to gfo:GFO_1337)

Predicted SEED Role

"FIG00694807: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNC6 at UniProt or InterPro

Protein Sequence (520 amino acids)

>CA264_02440 vitamin K epoxide reductase (Pontibacter actiniarum KMM 6156, DSM 19842)
MGKDKQNMQSEDGQEQGGMGMRGVTRPMAEKQMRKHHQKMQGHNDNGDHKDMKMDPEMRK
KMLHMHHQQTLWVYWLIMLLGAWVLISPLSFDYSIGTVQPSGGREVWLTMQQRISFMKWS
DIISGALLIFFGWRGLTPNRPVSLWICCFVGIWLTMAPLLFWAPTAVAYLNDTMVGALII
GLTILIPGMPNMIMYMEMGPKVPPGWSYNPSSWPQRWIMIVLGFVGWVVSRYLAAFQLGY
IDSVWDPFFGSQSEQVLNSSMSHSLPVSDAGLGAIAYTIEFLMGWMGSPARWRTMPWMVA
VFGIVVIPLGLVHIFLVISQPVVVGAWCTFCLLAAAIMLPMIPLEVDEVIAMVQFMKKKM
NKGEGFWKLFWKGGTIEGGEKEEHATEVMRLPEQPGKVFAASIWGMSFPWTLVVSTLLGI
ALVFAPGVFGVPIKDTVADVFHLSGSLMVVVSVICMGEPMRIGRYLNVLLGLAVAVAPWF
LGGPTALHITGVVLGLAVAALAFPLGPKTQRYAGWDEYIK