Protein Info for CA264_02410 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: adenosylmethionine--8-amino-7-oxononanoate transaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 TIGR00508: adenosylmethionine-8-amino-7-oxononanoate transaminase" amino acids 11 to 416 (406 residues), 544.1 bits, see alignment E=8.9e-168 PF00202: Aminotran_3" amino acids 21 to 416 (396 residues), 333.5 bits, see alignment E=1.6e-103 PF00155: Aminotran_1_2" amino acids 213 to 362 (150 residues), 20.7 bits, see alignment E=2.2e-08

Best Hits

KEGG orthology group: K00833, adenosylmethionine-8-amino-7-oxononanoate aminotransferase [EC: 2.6.1.62] (inferred from 64% identity to sli:Slin_5888)

Predicted SEED Role

"Adenosylmethionine-8-amino-7-oxononanoate aminotransferase (EC 2.6.1.62)" in subsystem Biotin biosynthesis (EC 2.6.1.62)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.62

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNG2 at UniProt or InterPro

Protein Sequence (438 amino acids)

>CA264_02410 adenosylmethionine--8-amino-7-oxononanoate transaminase (Pontibacter actiniarum KMM 6156, DSM 19842)
MNLAERDHNVIWHPYTQMKTAALPVPIVRGEGALLFSEDGTSYVDAVASWWVNLHGHAHP
YIAQKVTEQLNTLEHVIFAGFTHPAAVTFAERLLQILPQGQSRIFYSDNGSTAVEVALKM
AIQYWNNFGTPKKKIIAFRDSYHGDTFGAMSVSARSAFTVPFWSYLFEVQFIDVPTPGNE
EESVKQLETCALAGDVAAFIYEPLVLGTAGMVMYTPEVLDRLIEICRQHDILTIADEVMT
GFGRTGRTFATDYLQQKPDMVCLSKGLTGGTMALGATSCSEKVYEAFLHDDKGKTLFHGH
SYTANPVACAAGLASMDLLLQEETQESINRIVQRHAAFAASIKNLPQVLEVRQQGTILAV
EFEDGATSYFSDLRDTLYSFGLEKGVILRPLGNIIYVIPPYCITDQQLDQVYQAIVGMQE
IVTGKRHHPRPDLDMLHD