Protein Info for CA264_02405 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: beta-ketoacyl-ACP reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 PF00109: ketoacyl-synt" amino acids 6 to 244 (239 residues), 73.3 bits, see alignment E=2.6e-24 PF02801: Ketoacyl-synt_C" amino acids 255 to 358 (104 residues), 61 bits, see alignment E=1.1e-20

Best Hits

KEGG orthology group: None (inferred from 46% identity to rbi:RB2501_08035)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YXN0 at UniProt or InterPro

Protein Sequence (398 amino acids)

>CA264_02405 beta-ketoacyl-ACP reductase (Pontibacter actiniarum KMM 6156, DSM 19842)
MREEQKHIVIRGCGVISPLGYDAATTAAAYRKGAPAFSTVQHQGQPTPVAALPPEAEAQL
ELLLEANPTYKQLDRSVLMAVYAARHATEQAGWLHEKGPADDDLAVNIGSSRGATGLFET
HYEAFQQHNLSSSASPTTTLGNLSSWVAHAVNAGGGQISHSITCSTALMAVANGAAWLKA
GMAKRFLAGGTEAPLTDFTIAQMKAVGIYSRLVGQPYPCQPYAVEKQNTFTLGEGAAVFA
LEVQEKPLAGTAIVEAVGLGFEKLVSKTGISAEGINFQKAMRQALAQLPEPNPTVDLIIT
HTPGTRAGDKAELAAVQAVFGDAAPAITTNKWLLGHTLGASGALSLQYALHVLQQQQYAS
IPYPNLLTQAQPKPIQRVMVNAAGFGGNAASVVVRLAQ