Protein Info for CA264_02390 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: diaminopimelate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01048: diaminopimelate decarboxylase
  • amino acids 9 to 378 (370 residues), 404.3 bits, E=2.2e-125
• PF00278: Orn_DAP_Arg_deC
  • amino acids 16 to 359 (344 residues), 99.3 bits, E=1.9e-32
• PF01168: Ala_racemase_N
  • amino acids 20 to 223 (204 residues), 26.8 bits, E=6.2e-10
• PF02784: Orn_Arg_deC_N
  • amino acids 26 to 271 (246 residues), 185 bits, E=2.5e-58

Best Hits

Swiss-Prot: 59% identical to DCDA_BACTN: Diaminopimelate decarboxylase (lysA) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01586, diaminopimelate decarboxylase [EC: 4.1.1.20] (inferred from 67% identity to phe:Phep_2332)

Predicted SEED Role

"Diaminopimelate decarboxylase (EC 4.1.1.20)" in subsystem Lysine Biosynthesis DAP Pathway (EC 4.1.1.20)

MetaCyc Pathways

• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)
• L-lysine biosynthesis I (7/9 steps found)
• L-lysine biosynthesis II (7/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (11/15 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (12/18 steps found)
• aspartate superpathway (17/25 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.20

Sequence Analysis Tools

See A0A1X9YNH6 at UniProt or InterPro

Protein Sequence (380 amino acids)

>CA264_02390 diaminopimelate decarboxylase (Pontibacter actiniarum KMM 6156, DSM 19842)
MLKLNPEQLQQHATPFYAYDLNLLRQTLQSARQEAQKYNFHVHYALKANANAPVLAEMRQ
HGFGADCVSGNEVKAAIENGFAPKEVVFAGVGKSDEEINFALEQEIFCFNCESKHELEVL
NELAEKKGKTARVALRINPNVNANTHKYITTGLEENKFGINSWELDSVLELLQQLKHVEL
IGIHFHIGSQITDLTVFKNLCTRVNEFQEWFLAHNIRLEHVNVGGGLGVDYYNPEQHPIP
DFAAYFALFNQFLELRPGQQVHFELGRSLVAQCGTLVSRVLYIKNGISTNFAILDAGMTE
LIRPALYQSYHKIENLTSKKAEVRYDVVGPICESSDCFGKAVMLPETNRGDLIAIRSAGA
YGEVMASAYNLRDKAKAIYL