Protein Info for CA264_02350 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: nicotinate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 TIGR01513: nicotinate phosphoribosyltransferase" amino acids 12 to 467 (456 residues), 561.2 bits, see alignment E=9.4e-173 PF17767: NAPRTase_N" amino acids 13 to 143 (131 residues), 141.1 bits, see alignment E=3.5e-45 PF04095: NAPRTase" amino acids 165 to 345 (181 residues), 29.4 bits, see alignment E=9.4e-11 PF17956: NAPRTase_C" amino acids 371 to 475 (105 residues), 70 bits, see alignment E=3.4e-23

Best Hits

KEGG orthology group: K00763, nicotinate phosphoribosyltransferase [EC: 2.4.2.11] (inferred from 59% identity to wch:wcw_0536)

Predicted SEED Role

"Nicotinate phosphoribosyltransferase (EC 2.4.2.11)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or Redox-dependent regulation of nucleus processes (EC 2.4.2.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNB4 at UniProt or InterPro

Protein Sequence (488 amino acids)

>CA264_02350 nicotinate phosphoribosyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MALQQVYRTSLSLLTDLYQLTMAYGYWKNGMAEREAVFHLYFRKNPFGGGYTVAAGLEHA
VQYLQALKFTDEDLAYLGSLKGSQGQPLFEQAFLDYLGAMEFSCDMDAVPEGTVVFPNEP
LVRVKGPLLQAQLVETPLLTIINFETLIATKAARIKEAAKGDTVIEFGMRRAQGIDGSLS
AARAAYVGGADATSNLLAGQLYNIPVRGTHAHSWVQAFDSEEEAFEAYGEAFLQDTVLLV
DTYDTLEGVKKAIAVAKKLQPKGFVFGGIRLDSGDLTYLSQQARKLLDEAGFTGTSIVAS
NDLDERLITHLKQEGAKINVWGVGTKMITAYDQPALGGVYKLAAVKDGEWEYKIKLSEQL
AKTSNPGILQVRRYYDQERYQADMIYNELEPLPANPQIVDPLDTTRRKTVEANVQHKDLL
LPVFNKGTLIYTLPDLPSIKTYTQQELNQLHESIRRYLNPHSYPAGLESGLHQYKLDLIL
KLREPEKH