Protein Info for CA264_02325 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF07012: Curlin_rpt" amino acids 95 to 123 (29 residues), 21.9 bits, see alignment (E = 7.1e-09) amino acids 139 to 173 (35 residues), 29.8 bits, see alignment 2.3e-11 amino acids 162 to 196 (35 residues), 26.9 bits, see alignment 1.8e-10 amino acids 188 to 217 (30 residues), 24.4 bits, see alignment (E = 1.1e-09) amino acids 231 to 265 (35 residues), 40.9 bits, see alignment 8.1e-15 amino acids 254 to 288 (35 residues), 28.9 bits, see alignment 4.5e-11 amino acids 325 to 355 (31 residues), 27.4 bits, see alignment (E = 1.3e-10) amino acids 349 to 378 (30 residues), 24.5 bits, see alignment (E = 1.1e-09) amino acids 371 to 403 (33 residues), 32.3 bits, see alignment (E = 3.9e-12) amino acids 395 to 421 (27 residues), 22.3 bits, see alignment (E = 5.2e-09) amino acids 417 to 447 (31 residues), 27.7 bits, see alignment (E = 1.1e-10)

Best Hits

Predicted SEED Role

"Minor curlin subunit CsgB, nucleation component of curlin monomers" in subsystem Curli production

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNA4 at UniProt or InterPro

Protein Sequence (468 amino acids)

>CA264_02325 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MKKKVIYAATAALMFAAGSTFAQGVGNTATTAQAGNTNMATVDQVNGMGNVVVVQQNGTD
HDATVLQNNGELNNASITQAGNNNDATSAQYGGYDNDLTVAQYGANNDASVLQSGGSFHD
ASVLQSGENNAAATRQESGENNNLWIEQRGSDNEVTIDQFDGMNNEAMVNQHGVRQVAAV
TQEDGLGNSTLVNQEGDGNYAFVDQWGGEDNDAVVRQGGIENAAEVYQWGGDDNDARVTQ
AGYRNYTMVDQQDGRNNDADVTQDGSGNAAEVHQWGGVDTDARVNQTGDWNNAYVHQQGG
EENDVAVDQVGVGNAAAAMQVGGYDNDADFEQEGVANLAGIVQYGGAYNDAEIEQSGYFN
MAGIAQVEGYDNYALIEQEGSANLAGVLQLGGAYNSAYVSQDGDFNLAGVAQSGLYNTAT
IMQEGSSHAAAVLQGGALNSATINQMGGSGNAAGIMQLGVGNTSVINQ