Protein Info for CA264_02270 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: efflux transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details PF16576: HlyD_D23" amino acids 182 to 312 (131 residues), 37.5 bits, see alignment E=2.5e-13 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 187 to 402 (216 residues), 109.7 bits, see alignment E=7.2e-36 PF13437: HlyD_3" amino acids 234 to 321 (88 residues), 42.4 bits, see alignment E=1.5e-14 PF00529: CusB_dom_1" amino acids 341 to 400 (60 residues), 26.7 bits, see alignment E=6.5e-10

Best Hits

KEGG orthology group: K02005, HlyD family secretion protein (inferred from 47% identity to cpi:Cpin_0954)

Predicted SEED Role

"ABC transporter permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YN92 at UniProt or InterPro

Protein Sequence (416 amino acids)

>CA264_02270 efflux transporter periplasmic adaptor subunit (Pontibacter actiniarum KMM 6156, DSM 19842)
MDRVIEKKKATPKKIALIAAGALALVLVLYNLLFAEHSSKLNVDSERITTGQVSEGMFQE
FIAIDGSVDPLKSFYLDITEGGRVEKIYTDDGRTVQKGDTILKLSNTTLQIDFMTRETQL
YDLMNERQNSEITMKQDLIRKENELAEIEYNLALAKRKYERNKMLIEEKVISREEYEAAR
DEYEYLNKRKTLAERSVKQDAKLMEDRLKQLDESIRRMEANIGMARNTLNNLYVTAPFTG
QLSTLKAEVGESKAPGENIGQIDDLNGYKVKANIDEHYISRVYPGLHGSFDFNGKTYKIT
VAKVFPEVQNNTFQVDMEFAEGAPEGIRRGQTLQVKLNLNDGGKAVLIPRGGFYQSTGGN
WVFVVQEGANYAEKRRIKLGRQNPNYYEVLEGLQPGEKVVLSSYDSYGDIDRLELK