Protein Info for CA264_02265 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: phosphonate ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 28 to 175 (148 residues), 125.2 bits, E=3e-40

Best Hits

Swiss-Prot: 49% identical to Y1508_METJA: Uncharacterized ABC transporter ATP-binding protein MJ1508 (MJ1508) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K02003, (no description) (inferred from 69% identity to sli:Slin_4589)

MetaCyc: 42% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"ABC transporter ATP-binding protein"

MetaCyc Pathways

• lipoprotein posttranslational modification (Gram-negative bacteria) (2/7 steps found)

Sequence Analysis Tools

See A0A1X9YNE4 at UniProt or InterPro

Protein Sequence (239 amino acids)

>CA264_02265 phosphonate ABC transporter ATP-binding protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MNKEELIIDTRGLQKKYITDTVETTALAGVDLKIKRGEFVAIMGPSGCGKSTLLNILGML
DSPSSGSFLFLGQEVANVSERQRAKLRKQNLGFVFQSFNLIDELTVEENIGLPLAYLGYS
KSETEKRTLQAMERMGIAHRRNHFPQQLSGGQQQRAAIARAVVSEPALILADEPTGNLDS
VHGREVMQLLSELNEAGTTVVMVTHSPTDAEYAHRVVNLFDGQIVTENLNVKRHAAELL