Protein Info for CA264_02220 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: signal peptide peptidase SppA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 587 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details TIGR00705: signal peptide peptidase SppA, 67K type" amino acids 10 to 545 (536 residues), 469.6 bits, see alignment E=1.3e-144 PF01343: Peptidase_S49" amino acids 123 to 276 (154 residues), 97.5 bits, see alignment E=7.9e-32 amino acids 370 to 521 (152 residues), 165.7 bits, see alignment E=8e-53 TIGR00706: signal peptide peptidase SppA, 36K type" amino acids 306 to 519 (214 residues), 197.4 bits, see alignment E=2.3e-62 PF01972: SDH_sah" amino acids 334 to 409 (76 residues), 20 bits, see alignment E=3e-08

Best Hits

KEGG orthology group: K04773, protease IV [EC: 3.4.21.-] (inferred from 51% identity to sli:Slin_2408)

Predicted SEED Role

"Protease IV (EC 3.4.21.-)" (EC 3.4.21.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNC0 at UniProt or InterPro

Protein Sequence (587 amino acids)

>CA264_02220 signal peptide peptidase SppA (Pontibacter actiniarum KMM 6156, DSM 19842)
MLNFLKYVLATIVGLLIFFFIGILLLVGIAASTASKGEVEVAANSVLELKLDKPISERDP
EDPFAELGFSFGGFSSTDGLDQIKASIRRAKNDDDIEGIFLNMTFVDAGMAKLEEIRNEL
IEFKKSGKFVVSYTDLSTEKAYYLASVADRIYLNPMGTVEFNGMSSELFFFKRLLDKLNI
EAQIFKVGTYKSAVEPFFLEKASEANREQLNSFLNSINGYQLKQIAASRGITPEELENVQ
DNLLVRDPIDAKKYKLITDIGYYDEAISYIKEKIGVEEAEKLELVQLSKYKKVRHEAEIS
TSKNRIALIYAEGDIVDGEGDESSIGGRRFADAIREARLDEDVKAVVLRISSPGGSALAS
DIIWREIQLTKEVKPVIASMSDVAASGGYYIAMGCDTIVAHPNTITGSIGVFGVIPNVQG
FLNEKLGITVDHVSTGKFSDMPTITRPMTEQEKEIMQHQINQVYETFTGKAAKGRNMSQD
QLKEYASGRVWSGIEAKQRNLVDTFGGLEEALAIAAKKAGVEDDYRLKELPARKSFMEEL
LGGMGTQAKEQAIKADLGELYPFYKLYQKASSLKGIQARMPYELVVE