Protein Info for CA264_02215 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: AAA family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 PF05496: RuvB_N" amino acids 12 to 126 (115 residues), 61 bits, see alignment E=7.4e-20 PF00004: AAA" amino acids 45 to 150 (106 residues), 77.5 bits, see alignment E=8.4e-25 PF07728: AAA_5" amino acids 45 to 127 (83 residues), 26.4 bits, see alignment E=3.6e-09 PF20720: nSTAND3" amino acids 45 to 103 (59 residues), 28 bits, see alignment E=9.6e-10 PF13173: AAA_14" amino acids 45 to 157 (113 residues), 28 bits, see alignment E=1.2e-09 PF14532: Sigma54_activ_2" amino acids 47 to 131 (85 residues), 31 bits, see alignment E=1.7e-10 PF00158: Sigma54_activat" amino acids 92 to 145 (54 residues), 22.3 bits, see alignment 5.7e-08 PF16193: AAA_assoc_2" amino acids 179 to 249 (71 residues), 83.9 bits, see alignment E=4.7e-27 PF12002: MgsA_C" amino acids 250 to 414 (165 residues), 242.8 bits, see alignment E=1.1e-75

Best Hits

KEGG orthology group: K07478, putative ATPase (inferred from 68% identity to phe:Phep_0184)

Predicted SEED Role

"ATPase, AAA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YN81 at UniProt or InterPro

Protein Sequence (422 amino acids)

>CA264_02215 AAA family ATPase (Pontibacter actiniarum KMM 6156, DSM 19842)
MIHPNIPLAERMRPHNLDQYYGQKHLVGPNGILRRYIEGGVIPSMILWGPPGVGKTTLAN
IIANQMKVPFVALSAINSGVKDIREVIEQARKRQGTVLFIDEIHRFNKSQQDALLGAVEK
GTVTLVGATTENPSFEVISALLSRCQVYILKHLTKDELIELVDKALAQDEWMQHRKVRVQ
EYEALLTISGGDARKLLNLLEIVAEGVKAEEVVVTNELVKQVAQQNIVMYDKSGEMHYDL
VSAFIKSIRGSDPNAAVYWLARMIEGGEDPKFIARRLLIAASEDIGLANSNALLMATSCF
QAVQMIGYPEAEIILSQCTVYLATSPKSNASYKAIKQARALVQQTGNLPVPLHIRNAPTK
LMKEIGYGNNYKYAHDYEGNFVPQEFMPQELSHTALYKPGKNGRENEMLKQLQAQWGKKY
NY