Protein Info for CA264_02210 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: AI-2E family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 transmembrane" amino acids 17 to 47 (31 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 199 to 222 (24 residues), see Phobius details amino acids 228 to 251 (24 residues), see Phobius details amino acids 253 to 257 (5 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details amino acids 298 to 329 (32 residues), see Phobius details PF01594: AI-2E_transport" amino acids 17 to 332 (316 residues), 172.6 bits, see alignment E=6.3e-55

Best Hits

KEGG orthology group: None (inferred from 64% identity to phe:Phep_2317)

Predicted SEED Role

"permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNC8 at UniProt or InterPro

Protein Sequence (384 amino acids)

>CA264_02210 AI-2E family transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MSEMPLTVRRSIEVMGLFFLGWVVVLANGLLAPLLMAFFISIMLLPIYRFFTSRKVPETV
AIAISLLVLALVMGLIVWFFSSQISDLVRDFPIIQRNVTKHLNDLSEWVGSFTPYSTAEQ
VALIRDQSNRLLSYAGGLLSGAALSLTSVLVFLGLLPIYIFLIMFYKNLLLRFVFLWFPP
KNYRRVRETLREMEVIIKSYLFGLLIQVSYMTVLLGGILLIIGIKHALLIGVIFAFLNLI
PYVGALLGNVIGVLITLASAAELWPIIVVLGTIAAVQFLDNNILMPRIVGSKVKINALAA
IVGVLVAGEVAGIPGMFLSLPIIAVLKVIFDRSERFKQWGVLFGDERPEHSPMNYPALRE
QDKAARQGLTWENQGGLPGEGGAP