Protein Info for CA264_02190 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 PF07992: Pyr_redox_2" amino acids 10 to 301 (292 residues), 96.1 bits, see alignment E=1.1e-30 PF00890: FAD_binding_2" amino acids 11 to 42 (32 residues), 22.8 bits, see alignment 2.1e-08 TIGR04018: putative bacillithiol system oxidoreductase, YpdA family" amino acids 11 to 324 (314 residues), 478.6 bits, see alignment E=3.2e-148 PF13738: Pyr_redox_3" amino acids 13 to 295 (283 residues), 330.5 bits, see alignment E=4e-102 PF13434: Lys_Orn_oxgnase" amino acids 74 to 227 (154 residues), 28.5 bits, see alignment E=3.4e-10 PF00070: Pyr_redox" amino acids 164 to 233 (70 residues), 22.7 bits, see alignment E=4.8e-08

Best Hits

Swiss-Prot: 44% identical to YPDA_BACSU: Uncharacterized protein YpdA (ypdA) from Bacillus subtilis (strain 168)

KEGG orthology group: K00384, thioredoxin reductase (NADPH) [EC: 1.8.1.9] (inferred from 67% identity to cpi:Cpin_6573)

Predicted SEED Role

"Thioredoxin reductase (EC 1.8.1.9)" in subsystem Glycine reductase, sarcosine reductase and betaine reductase or Thioredoxin-disulfide reductase or Wyeosine-MimG Biosynthesis (EC 1.8.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.9

Use Curated BLAST to search for 1.8.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YN83 at UniProt or InterPro

Protein Sequence (329 amino acids)

>CA264_02190 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MNKKNLDTTYDIVIIGAGPIGLAAGLEAQKAGLSYLIVEKGCLVNSIYNYPLNMTFFSTS
ERLEIGGVPFTSLNAKPTRAEALEYYRRVAEKFALNIHLFEAVERLQPEGGLYRLSTSKG
EYRARHVVVAVGFYGIPNLLHVPGENLPKVRHYYFDPHYYYRQKVVVVGANNSAADAALE
TWRKGADVTLVVRQAELGSIKYWTKPDLENRIKEGEIKAYFNASITEVRGREVDIQTPEG
KLTLENDFVLAMTGYQPDFSFLQQMGVNLTEDEKRYPQYDPETMETNLPNVYLAGVICGG
MDTHVWFIENSREHAVKIVRHIKQEAERV