Protein Info for CA264_02130 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: pseudouridine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 PF00849: PseudoU_synth_2" amino acids 2 to 148 (147 residues), 84.2 bits, see alignment E=5.8e-28 TIGR00093: pseudouridine synthase" amino acids 7 to 178 (172 residues), 184.5 bits, see alignment E=5.9e-59

Best Hits

Swiss-Prot: 52% identical to RLUE_SALTY: Ribosomal large subunit pseudouridine synthase E (rluE) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K06181, ribosomal large subunit pseudouridine synthase E [EC: 5.4.99.12] (inferred from 60% identity to hil:HICON_07990)

Predicted SEED Role

"Ribosomal large subunit pseudouridine synthase E (EC 4.2.1.70)" (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YN88 at UniProt or InterPro

Protein Sequence (224 amino acids)

>CA264_02130 pseudouridine synthase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKYIIVNKPYEVLTQFTDEAGRATLKDFVPVPDIYPVGRLDYDSEGLVLLTDDKQLQHRL
SDPKFKVEKTYLVQVDNIPTDDALTRLRLGVQIKGTKTAPAKVRLLEEAPLVWERSKPVR
FRKEIPTAWLEIRISQGMNRQVRRMTAAVGFPTLRLIRPTIGPLSLGDLQPGEYRELTPE
EVQQLKAARKASTGSSSNTRGKNFGGGSKGKRSGGKGGFRKQIN