Protein Info for CA264_02100 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: Clp protease ClpC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 865 PF02861: Clp_N" amino acids 17 to 66 (50 residues), 57 bits, see alignment 1.2e-18 amino acids 97 to 141 (45 residues), 39.3 bits, see alignment 3.7e-13 PF00004: AAA" amino acids 230 to 341 (112 residues), 45.6 bits, see alignment E=6.6e-15 amino acids 567 to 684 (118 residues), 32.5 bits, see alignment E=7.1e-11 PF17871: AAA_lid_9" amino acids 369 to 470 (102 residues), 117.9 bits, see alignment E=1.1e-37 PF07724: AAA_2" amino acids 561 to 734 (174 residues), 227.8 bits, see alignment E=5.1e-71 PF00158: Sigma54_activat" amino acids 564 to 673 (110 residues), 27.8 bits, see alignment E=1.2e-09 PF07728: AAA_5" amino acids 566 to 691 (126 residues), 40.5 bits, see alignment E=1.8e-13 PF10431: ClpB_D2-small" amino acids 741 to 821 (81 residues), 94.5 bits, see alignment E=2.1e-30

Best Hits

KEGG orthology group: K03696, ATP-dependent Clp protease ATP-binding subunit ClpC (inferred from 79% identity to chu:CHU_1079)

Predicted SEED Role

"ATP-dependent Clp protease ATP-binding subunit ClpA" in subsystem Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YNA9 at UniProt or InterPro

Protein Sequence (865 amino acids)

>CA264_02100 Clp protease ClpC (Pontibacter actiniarum KMM 6156, DSM 19842)
MEAKFSNRVKEVISLSREEAIRLGHDYIGTEHLVLGMIREGEGTAVALLKKLGVSIDELK
YALEQATRNTASQSSNITGSIPLTKQTEKVLKITYLEAKIFKSDIIGTEHLLLSILRDED
NISSQILGKFNVNYEAIRDSLDYHSNNPLASSDTDDSDDSDKLFGSSSSRSGSSSSKKPG
EKSRTPVLDNFGRDLTKLAEDDKLDPIVGREKEIERVAQVLSRRKKNNPILIGEPGVGKT
AIAEGLALRIVQKKVSRVLFNKRVVTLDLASLVAGTKYRGQFEERMKAVMNELEKSPDVI
LFIDELHTIVGAGGASGSLDASNMFKPALARGEIQCIGATTLDEYRQYIEKDGALARRFQ
IVMVDPTTPEETIEILNNIKDKYQDHHHVNYTDKAIEACVKLSDRYMSDRFLPDKAIDIL
DEAGARVHINNIVVPDDILKLEEQIENIKVEKNRVVKSQKYEEAAQLRDKEKKLIDQLDS
AKKNWEEETKKKRYQVKEENVAEVIAMMTGIPVKRIAQKEGVKLLNMGEELKGKVIGQDK
AIGQLVKAIQRTRVGLKDPKKPIGSFVFLGPTGVGKTELAKVLATYLFDKEDSLVRIDMS
EYMEKFSVSRLVGAPPGYVGYEEGGQLTEKIRRKPYSVVLLDEIEKAHPDVYNLLLQVLD
DGILTDGLGRKVDFRNTIIIMTSNIGARDLQDFGAGIGFMSKSKQENVDDIMKGTIASAL
KKTFSPEFLNRLDDVIVFNSLNREDMHKIIELSLSKLFTRVESLGYTIELTKEAKDFVAE
KGYDPKYGARPLNRAIQKYIEDPIAEEILKAEVNQGDVIQVSHKEGEEKLTFTSKKSNSK
KAKGASDEAEETEPSKSSDSDKTKE