Protein Info for CA264_02095 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: AI-2E family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 18 to 46 (29 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details amino acids 200 to 221 (22 residues), see Phobius details amino acids 227 to 250 (24 residues), see Phobius details amino acids 262 to 284 (23 residues), see Phobius details amino acids 298 to 326 (29 residues), see Phobius details PF01594: AI-2E_transport" amino acids 17 to 328 (312 residues), 165.6 bits, see alignment E=8.5e-53

Best Hits

KEGG orthology group: None (inferred from 30% identity to ppn:Palpr_2671)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YN59 at UniProt or InterPro

Protein Sequence (352 amino acids)

>CA264_02095 AI-2E family transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MDNSSGINWLKWLQYTVLLSLILYVGRTLFIPLSFALLISFVLYPICKWLERKGLPRWAA
ILLCLLLLVVLVGGLGFLLIKQMLRFGQEWPSLQAKLLATWQNLSAYLERHYAIDAAAQI
AWVERMAGEIAASAFAMAQDVVYTSAVSLVLFVLIPIYVALILYNREQFTSALYSLFSQE
EHRKIHQILHETITTYYNFIKGMVVVYVVVGVLNSLGLFLMGVPHAVFFGVVASILTFIP
YVGITIGAILPMTVAWVTYDSVWYPLGVIIVFSVVQYLEANLIFPWAVSARLQVNMLFTL
LAIVAGGILWGASGMILFIPFLAILKLIADKHEGMRPVSLLLGSGEKGKAQA